Posts by Sir Stooper

1) Message boards : Number crunching : Computation errors with BOINC 7.0.25 (WinXP 32 bit) (Message 73009) Posted 6 May 2012 by Sir Stooper Post: I was getting errors on 7.0.25 and then 7.0.26, but I have since changed to 7.0.27 and things are much better. gone from about 50% error to about 2 in two days. I also switched Rosetta preferences to 1hr/WU. On the errors left, it seems to be happening after 'Setting up graphics native' ... Unpacking zip data: ../../projects/boinc.bakerlab.org_rosetta/minirosetta_database_rev48292.zip Setting database description ... Setting up checkpointing ... Setting up graphics native ... EFPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALME can not find a residue type that matches the residue PRO_p:pro_hydroxylated_case1at position 3 ERROR: core::util::switch_to_residue_type_set fails ERROR:: Exit from: ......srccoreutilSwitchResidueTypeSet.cc line: 143 BOINC:: Error reading and gzipping output datafile: default.out called boinc_finish </stderr_txt> Using on both computers: Phenom IIs Windows 7 64 AMD HD5870 on one shrubbing MilkyWay, HD5770 on another shrubbing POEM. Just my observations.