Posts by Sir Stooper

1) Message boards : Number crunching : Computation errors with BOINC 7.0.25 (WinXP 32 bit) (Message 73009)
Posted 6 May 2012 by Profile Sir Stooper
Post:
I was getting errors on 7.0.25 and then 7.0.26, but I have since changed to 7.0.27 and things are much better. gone from about 50% error to about 2 in two days. I also switched Rosetta preferences to 1hr/WU. On the errors left, it seems to be happening after 'Setting up graphics native'
...
Unpacking zip data: ../../projects/boinc.bakerlab.org_rosetta/minirosetta_database_rev48292.zip
Setting database description ...
Setting up checkpointing ...
Setting up graphics native ...
EFPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALME
can not find a residue type that matches the residue PRO_p:pro_hydroxylated_case1at position 3

ERROR: core::util::switch_to_residue_type_set fails

ERROR:: Exit from: ......srccoreutilSwitchResidueTypeSet.cc line: 143
BOINC:: Error reading and gzipping output datafile: default.out
called boinc_finish

</stderr_txt>


Using on both computers:
Phenom IIs
Windows 7 64
AMD HD5870 on one shrubbing MilkyWay, HD5770 on another shrubbing POEM.

Just my observations.






©2026 University of Washington
https://www.bakerlab.org