Message boards : Number crunching : Rosetta@Home Version 3.24
Previous · 1 · 2 · 3
| Author | Message |
|---|---|
Greg_BESend message Joined: 30 May 06 Posts: 5770 Credit: 6,139,760 RAC: 0 |
Rocco, ok, thanks. You talking about version 3.26 that is out now? |
|
Rocco Moretti Send message Joined: 18 May 10 Posts: 66 Credit: 585,745 RAC: 0 |
You talking about version 3.26 that is out now? Right. 3.26 should hopefully fix most of the CASP9/rb workunit-related issues. |
|
P . P . L . Send message Joined: 20 Aug 06 Posts: 581 Credit: 4,865,274 RAC: 0 |
Hi. Got two more with errors first one ran for 47min & did the 99 the other ran for 9sec then erred. https://boinc.bakerlab.org/rosetta/workunit.php?wuid=452618941 sh3_d310_design_010_relax_SAVE_ALL_OUT_46196_233_0 cpu_run_time_pref: 14400 ====================================================== DONE :: 99 starting structures 2840.33 cpu seconds This process generated 99 decoys from 99 attempts ====================================================== BOINC :: WS_max 0 BOINC :: Watchdog shutting down... BOINC :: BOINC support services shutting down cleanly ... called boinc_finish </stderr_txt> ]]> Validate state Invalid ========================================================== https://boinc.bakerlab.org/rosetta/workunit.php?wuid=452649604 ab_11_29__optpps_T5311_optpps_03_09_35686_254232_0 Setting up checkpointing ... Setting up graphics native ... EFPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALME can not find a residue type that matches the residue PRO_p:pro_hydroxylated_case1at position 3 ERROR: core::util::switch_to_residue_type_set fails ERROR:: Exit from: src/core/util/SwitchResidueTypeSet.cc line: 143 BOINC:: Error reading and gzipping output datafile: default.out called boinc_finish </stderr_txt> ]]>
|
Message boards :
Number crunching :
Rosetta@Home Version 3.24
©2025 University of Washington
https://www.bakerlab.org