Computation errors with BOINC 7.0.25 (WinXP 32 bit)

Message boards : Number crunching : Computation errors with BOINC 7.0.25 (WinXP 32 bit)

To post messages, you must log in.

1 · 2 · Next

AuthorMessage
vdquang

Send message
Joined: 29 Sep 06
Posts: 9
Credit: 1,442,872
RAC: 954
Message 72760 - Posted: 14 Apr 2012, 21:35:48 UTC

I have just updated to BOINC ver. 7.0.25. However, computation errors happened with all 7 work units (6 out of them were newly downloaded ones since the update). Should I revert to the old version 6.12.34?
ID: 72760 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Mod.Sense
Volunteer moderator

Send message
Joined: 22 Aug 06
Posts: 4018
Credit: 0
RAC: 0
Message 72763 - Posted: 15 Apr 2012, 0:13:14 UTC

It looks as though there must be some problem work units out there. As your failures were reported, the tasks were reissued to other machines and failed there as well under various BOINC versions.

Is anyone else having problems with task names starting with "rb_04_12" & "rb_04_13"??
Rosetta Moderator: Mod.Sense
ID: 72763 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
BobbyG

Send message
Joined: 6 Mar 06
Posts: 4
Credit: 711,077
RAC: 0
Message 72840 - Posted: 20 Apr 2012, 0:18:20 UTC - in response to Message 72763.  

It looks as though there must be some problem work units out there. As your failures were reported, the tasks were reissued to other machines and failed there as well under various BOINC versions.

Is anyone else having problems with task names starting with "rb_04_12" & "rb_04_13"??


I have been getting several computation errors since I installed Boinc 7.0.25 x(64). The latest starts with aa_centroid_cst.
ID: 72840 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Around

Send message
Joined: 16 Oct 11
Posts: 3
Credit: 474,717
RAC: 0
Message 72849 - Posted: 20 Apr 2012, 23:26:26 UTC

I am experiencing the same issue with 7.0.25 (x64). Of my most recent 84 tasks, 66 have computation errors with only 18 successes.

Cheers,

Adrian
ID: 72849 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Wayne Miller

Send message
Joined: 10 Feb 06
Posts: 5
Credit: 113,654
RAC: 0
Message 72851 - Posted: 21 Apr 2012, 3:33:18 UTC

I too can verify that since upgrading to Boinc 7.0.25 (x64) most of my work units have computation errors.


ID: 72851 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Rick

Send message
Joined: 29 Mar 12
Posts: 1
Credit: 85,917
RAC: 0
Message 72852 - Posted: 21 Apr 2012, 15:55:08 UTC

I have been having the same problem with BOINC 7.0.25 (WinXP 64 bit). Any ideas on a fix?
ID: 72852 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Fi and Charlie Shaw

Send message
Joined: 7 May 07
Posts: 8
Credit: 346,961
RAC: 0
Message 72909 - Posted: 28 Apr 2012, 12:48:50 UTC

I'm crunching Rosetta on a 32bit machine, so I don't think the 64 bit argument below can be valid.

Yesterday 27/4/2012 I was getting more and more client errors using BOINC 7.0.025.

In frustration I stopped my crunching with Rosetta and replaced BOINC with version 6.12.34 which can still be downloaded from the BOINC website.

Since then, I have had no client errors.

So on conclusion, something seems amiss with BOINC 7.0.25 and Rosetta.

My other 2 64bit computers are crunching other projects seperatley and are not experiencing any issues with BOINC 7.0.25 yet !

Its a temporary solution, in my case, and I hope it helps others, until the situation is resolved.

Swordfish
ps apologies to moderators for posting originally in wrong thread
ID: 72909 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Profile Greg_BE
Avatar

Send message
Joined: 30 May 06
Posts: 5664
Credit: 5,711,666
RAC: 422
Message 72918 - Posted: 29 Apr 2012, 6:37:37 UTC

Since BOINC 7 has come out there have been some people that are having issues with tasks erroring out or running high priority all the time and grabbing all the cores in the process. On another project someone has posted this issue on the BOINC error board and has heard back that BOINC will put the fix in the next version, whenever that is. So you might as well stay with Version 6 for now until the next version of BOINC comes out.
ID: 72918 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
kislov

Send message
Joined: 26 May 11
Posts: 1
Credit: 71,293
RAC: 0
Message 72937 - Posted: 30 Apr 2012, 14:39:42 UTC

Same here ! Just installed the latest version of BOINC, and most of the tasks from Rosetta end up with Computation Error, with is not the case with other projects: Milkyway, Einstein, Orbit, SETI, Cosmology - they have no errors at all.
I run Win7 64 bit.
ID: 72937 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Profile Greg_BE
Avatar

Send message
Joined: 30 May 06
Posts: 5664
Credit: 5,711,666
RAC: 422
Message 72939 - Posted: 30 Apr 2012, 14:43:30 UTC - in response to Message 72937.  

Same here ! Just installed the latest version of BOINC, and most of the tasks from Rosetta end up with Computation Error, with is not the case with other projects: Milkyway, Einstein, Orbit, SETI, Cosmology - they have no errors at all.
I run Win7 64 bit.



Just set your projects to no new work. Finish what you have and then go back to version 6 if you want to keep running all projects without errors.
ID: 72939 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
mikey
Avatar

Send message
Joined: 5 Jan 06
Posts: 1894
Credit: 8,781,454
RAC: 2,034
Message 72959 - Posted: 1 May 2012, 10:32:03 UTC - in response to Message 72937.  

Same here ! Just installed the latest version of BOINC, and most of the tasks from Rosetta end up with Computation Error, with is not the case with other projects: Milkyway, Einstein, Orbit, SETI, Cosmology - they have no errors at all.
I run Win7 64 bit.


Rosetta has a known problem with the version 7 series of Boinc, stop using it or find another project until they fix it is my suggestion.
ID: 72959 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Profile The Ancient One

Send message
Joined: 4 Oct 05
Posts: 11
Credit: 751,429
RAC: 83
Message 73006 - Posted: 6 May 2012, 17:01:19 UTC

Get it as regular as clock work. It turns out to be a missing file (usually .ini)
so although the wu has been completed it cant wright to the .ini file as the address quoted is not their it is in another file or folder address or in deed missing altogether.
ID: 73006 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Profile Sir Stooper
Avatar

Send message
Joined: 9 May 10
Posts: 1
Credit: 2,507,341
RAC: 5,865
Message 73009 - Posted: 6 May 2012, 22:43:18 UTC

I was getting errors on 7.0.25 and then 7.0.26, but I have since changed to 7.0.27 and things are much better. gone from about 50% error to about 2 in two days. I also switched Rosetta preferences to 1hr/WU. On the errors left, it seems to be happening after 'Setting up graphics native'
...
Unpacking zip data: ../../projects/boinc.bakerlab.org_rosetta/minirosetta_database_rev48292.zip
Setting database description ...
Setting up checkpointing ...
Setting up graphics native ...
EFPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALME
can not find a residue type that matches the residue PRO_p:pro_hydroxylated_case1at position 3

ERROR: core::util::switch_to_residue_type_set fails

ERROR:: Exit from: ......srccoreutilSwitchResidueTypeSet.cc line: 143
BOINC:: Error reading and gzipping output datafile: default.out
called boinc_finish

</stderr_txt>


Using on both computers:
Phenom IIs
Windows 7 64
AMD HD5870 on one shrubbing MilkyWay, HD5770 on another shrubbing POEM.

Just my observations.
ID: 73009 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Fi and Charlie Shaw

Send message
Joined: 7 May 07
Posts: 8
Credit: 346,961
RAC: 0
Message 73069 - Posted: 16 May 2012, 5:42:39 UTC

I've just gone back to version 7.026 and I'm getting errors again.

As i'm not prepared to waste anymore valuable computing time on unpredictable results, I've detatched from the project until matters are resolved.

Yes I could go back to version 6.xxx as I did do earlier in this thread, but I'm not faffing around anymore.

I dont have any problems with Seti, on all 3 of my machines running 7.026, and that where I will stay until this is sorted.

Swordfish
ID: 73069 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Charles Tomaras

Send message
Joined: 18 Aug 09
Posts: 11
Credit: 21,596,904
RAC: 27,374
Message 73172 - Posted: 30 May 2012, 19:46:51 UTC

I'm having about a 2/3'rd failure rate on ALL my Rosetta work units since the 7.0.25 Boinc update. Reports back Client Error and Compute Error. This version of Boinc and my CPU are fine with SETI work units on all cores so I think the problem is specific to the Rosetta project and this latest update. Is this on the radar? Is a fix at hand? Here's what's reported from my most recent failed work unit:

509376616
Name jsr_decoys_centroid_2oss_SAVE_ALL_OUT_50596_640_0
Workunit 464057852
Created 30 May 2012 6:00:33 UTC
Sent 30 May 2012 6:01:11 UTC
Received 30 May 2012 19:41:14 UTC
Server state Over
Outcome Client error
Client state Compute error
Exit status 1 (0x1)
Computer ID 1488309
Report deadline 9 Jun 2012 6:01:11 UTC
CPU time 6682.552
stderr out <core_client_version>7.0.25</core_client_version>
<![CDATA[
<message>
Incorrect function. (0x1) - exit code 1 (0x1)
</message>
<stderr_txt>
[2012- 5-30 10:14:10:] :: BOINC:: Initializing ... ok.
[2012- 5-30 10:14:10:] :: BOINC :: boinc_init()
BOINC:: Setting up shared resources ... ok.
BOINC:: Setting up semaphores ... ok.
BOINC:: Updating status ... ok.
BOINC:: Registering timer callback... ok.
BOINC:: Worker initialized successfully.
Registering options..
Registered extra options.
Initializing broker options ...
Registered extra options.
Initializing core...
Initializing options.... ok
Options::initialize()
Options::adding_options()
Options::initialize() Check specs.
Options::initialize() End reached
Loaded options.... ok
Processed options.... ok
Initializing random generators... ok
Initialization complete.
Initializing options.... ok
Options::initialize()
Options::adding_options()
Options::initialize() Check specs.
Options::initialize() End reached
Loaded options.... ok
Processed options.... ok
Initializing random generators... ok
Initialization complete.
Setting WU description ...
Unpacking zip data: ../../projects/boinc.bakerlab.org_rosetta/minirosetta_database_rev48292.zip
Unpacking WU data ...
Unpacking data: ../../projects/boinc.bakerlab.org_rosetta/2oss_homfrags.zip
Setting database description ...
Setting up checkpointing ...
Setting up graphics native ...
Setting up folding (abrelax) ...
Beginning folding (abrelax) ...
BOINC:: Worker startup.
Starting watchdog...
Watchdog active.
Starting work on structure: _00001
Starting work on structure: _00002
Starting work on structure: _00003
Starting work on structure: _00004
Starting work on structure: _00005
Starting work on structure: _00006
Starting work on structure: _00007
Starting work on structure: _00008
Starting work on structure: _00009
Starting work on structure: _00010
Starting work on structure: _00011

</stderr_txt>
]]>


Validate state Invalid
Claimed credit 68.5895906965126
Granted credit 0
application version 3.31
ID: 73172 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
mikey
Avatar

Send message
Joined: 5 Jan 06
Posts: 1894
Credit: 8,781,454
RAC: 2,034
Message 73175 - Posted: 31 May 2012, 11:01:36 UTC - in response to Message 73172.  

I'm having about a 2/3'rd failure rate on ALL my Rosetta work units since the 7.0.25 Boinc update. Reports back Client Error and Compute Error. This version of Boinc and my CPU are fine with SETI work units on all cores so I think the problem is specific to the Rosetta project and this latest update. Is this on the radar? Is a fix at hand?


NO...Rosetta does NOT support the Version 7 series of Boinc and has NO PLANS to change anything! They are quite happy with how things are going right now. Many of us have moved on to other projects as a result.
ID: 73175 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Old man

Send message
Joined: 10 Nov 07
Posts: 25
Credit: 1,122,372
RAC: 0
Message 73176 - Posted: 31 May 2012, 11:32:41 UTC - in response to Message 73175.  

I'm having about a 2/3'rd failure rate on ALL my Rosetta work units since the 7.0.25 Boinc update. Reports back Client Error and Compute Error. This version of Boinc and my CPU are fine with SETI work units on all cores so I think the problem is specific to the Rosetta project and this latest update. Is this on the radar? Is a fix at hand?


NO...Rosetta does NOT support the Version 7 series of Boinc and has NO PLANS to change anything! They are quite happy with how things are going right now. Many of us have moved on to other projects as a result.


But...i have 7.0.25 boinc version on my win 7 machine. I run now rosetta and all working fine. What i have done wrong because all working fine?
ID: 73176 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Mod.Sense
Volunteer moderator

Send message
Joined: 22 Aug 06
Posts: 4018
Credit: 0
RAC: 0
Message 73180 - Posted: 31 May 2012, 18:49:01 UTC - in response to Message 73175.  

NO...Rosetta does NOT support the Version 7 series of Boinc and has NO PLANS to change anything! They are quite happy with how things are going right now. Many of us have moved on to other projects as a result.


I should point out that mikey is speaking for himself and not for Rosetta@home. Mikey's comments are based on observation, without knowledge of the project's intentions.
Rosetta Moderator: Mod.Sense
ID: 73180 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
mikey
Avatar

Send message
Joined: 5 Jan 06
Posts: 1894
Credit: 8,781,454
RAC: 2,034
Message 73186 - Posted: 1 Jun 2012, 12:01:05 UTC - in response to Message 73180.  

NO...Rosetta does NOT support the Version 7 series of Boinc and has NO PLANS to change anything! They are quite happy with how things are going right now. Many of us have moved on to other projects as a result.


I should point out that mikey is speaking for himself and not for Rosetta@home. Mikey's comments are based on observation, without knowledge of the project's intentions.


You are more than welcome to say that but the Admin Michael said the same thing in one of his messages! Now it could be he has no clue either but one would think an Admin posting as an Admin would be responsible!
ID: 73186 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
Profile ArgiesDario

Send message
Joined: 17 Sep 10
Posts: 3
Credit: 1,291,154
RAC: 0
Message 73336 - Posted: 24 Jun 2012, 15:16:19 UTC

guys, same here, since update i been getting lots of troubles!!, 90% of my tasks finish with computer errors!! :(

u can see it here: https://boinc.bakerlab.org/rosetta/results.php?hostid=1531171

with my others pc with older versions of boinc its working great.

is there any admin information why this isnt working fine??, should i change proyect or dowload older version?... btw... where i can get an older version of boinc ?

thanks!
ID: 73336 · Rating: 0 · rate: Rate + / Rate - Report as offensive    Reply Quote
1 · 2 · Next

Message boards : Number crunching : Computation errors with BOINC 7.0.25 (WinXP 32 bit)



©2024 University of Washington
https://www.bakerlab.org