1)
Message boards :
Rosetta@home Science :
DISCUSSION of Rosetta@home Journal (5)
(Message 72898)
Posted 26 Apr 2012 by edikl Post: In the last two months we believe we have made quite a breakthrough in structure prediction, and are excited to test the new method in CASP10. I couldn't agree more :) |
2)
Message boards :
Number crunching :
Minirosetta 3.20
(Message 72181)
Posted 19 Jan 2012 by edikl Post: Initialization complete. Setting WU description ... Unpacking zip data: ../../projects/boinc.bakerlab.org_rosetta/minirosetta_database_rev46858.zip Setting database description ... Setting up checkpointing ... Setting up graphics native ... EFPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALME can not find a residue type that matches the residue PRO_p:pro_hydroxylated_case1at position 3 ERROR: core::util::switch_to_residue_type_set fails ERROR:: Exit from: ......srccoreutilSwitchResidueTypeSet.cc line: 143 BOINC:: Error reading and gzipping output datafile: default.out called boinc_finish http://boinc.bakerlab.org/rosetta/workunit.php?wuid=435881534 |
3)
Message boards :
Number crunching :
These 7 files will not upload.
(Message 71995)
Posted 8 Jan 2012 by edikl Post: Hi! I can confirm that your advice works perfectly under Windows Vista as well. Thanks a lot :) |
4)
Message boards :
Number crunching :
Problems and Technical Issues with Rosetta@home
(Message 71688)
Posted 1 Dec 2011 by edikl Post: Come on Administrators, give us some explanation on what's going on with Rosetta. I've just got 0 credits for my tasks.. Is it really so difficult for you to write one or two sentences of explanation on Rosetta's main page? I don't believe that any of you doesn't have a minute to do that.. I won't stop crunching, because I do know that in future it will help humanity to fight many deadly diseases. But it's not fair how you treat us.. I am almost sure that my message will not change your attitude towards us at all. At least it's helped me to calm down a bit ;) |
5)
Message boards :
Number crunching :
Web Site Updates
(Message 71169)
Posted 31 Aug 2011 by edikl Post: Just as I thought, not even a single word from Project Administrators.. It starts to annoy me. Whatever... |
6)
Message boards :
Number crunching :
Web Site Updates
(Message 71142)
Posted 25 Aug 2011 by edikl Post: There is nothing more to add, sadly... I have been a Rosetta participant for more than a year now. I know that being a part of this project is really something. But please, is it so difficult to post a brief info about what is going on here? I will quote some of my previous posts: "I agree with Mike, that it would be nice if we were kept up to date with what's currently going on here. Our computers are crunching new workunits all the time, but we have no idea what exactly they are. A key to success is being well informed, and that's what we ask you for. Just give us some more detailed info about current activity of Rosetta every now and then." "It is normal that sometimes things go wrong. But it would be nice to hear a word from project administrators, that we have a problem (why and when it is predicted to be fixed). We, users, like to know that we are treated seriously". And no reply to this... I know that Project Administrators are busy guys, but please, Rosetta is a part of their work, isn't it? We do not want miracles... Sometimes one sentence would be enough to have everyone satisfied. Our computers crunch workunits, that is correct. But I feel as if this project was dead - due to the lack of communication with us - volunteers. Having the above in mind, Dear Project Administrators - please start treating us seriously. You must remember that there are plenty of other projects, not only Rosetta. Edikl |
7)
Message boards :
Number crunching :
with weight5_wo no graphics
(Message 70514)
Posted 7 Jun 2011 by edikl Post: Hi :) Sometimes I have the same issue. No idea why is that, but even though, these workunits are crunched normally :) |
8)
Message boards :
Number crunching :
Problems and Technical Issues with Rosetta@home
(Message 70409)
Posted 27 May 2011 by edikl Post: It is normal that sometimes things go wrong. But it would be nice to hear a word from project administrators, that we have a problem (why and when it is predicted to be fixed). We, users, like to know that we are treated seriously :) |
9)
Message boards :
Rosetta@home Science :
Design of protein-protein interfaces
(Message 70282)
Posted 8 May 2011 by edikl Post: Hi! My computer is crunching something like this at the moment: MVH_2s_K_2q6m_ProteinInterfaceDesign_20110505_26665_45_0 And I think this must be what we're talking about ;) Am I right? |
10)
Message boards :
Rosetta@home Science :
Rosetta Active Workunit Log
(Message 69903)
Posted 27 Mar 2011 by edikl Post: Hi everyone. This is my first post here, but I've been a Rosetta user for some time. I agree with Mike, that it would be nice if we were kept up to date with what's currently going on here. Our computers are crunching new workunits all the time, but we have no idea what exactly they are. A key to success is being well informed, and that's what we ask you for. Just give us some more detailed info about current activity of Rosetta every now and then. PS. Sorry for my English ;) All the best, edikl |
©2024 University of Washington
https://www.bakerlab.org